PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_10198.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MYB
Protein Properties Length: 302aa    MW: 34827.6 Da    PI: 10.3436
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_10198.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-181863147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             rg W + Ede+l ++v+q+G+ +W++Ia++++ gR++k+c++rw++ 
  Sme2.5_10198.1_g00001.1 18 RGHWRPAEDERLRQLVEQYGPQNWNSIAEKLQ-GRSGKSCRLRWFNQ 63
                             899*****************************.***********996 PP

2Myb_DNA-binding58.21.9e-1870114147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              r +++++E+e+lv a++ +G++ W++I+r ++ gRt++ +k++w+ +
  Sme2.5_10198.1_g00001.1  70 RRPFSEDEEERLVAAHRIHGNK-WALISRLFP-GRTDNAVKNHWHVL 114
                              679*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.2681364IPR017930Myb domain
SMARTSM007179.5E-151766IPR001005SANT/Myb domain
SuperFamilySSF466894.87E-2917111IPR009057Homeodomain-like
PfamPF002491.4E-171863IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-261971IPR009057Homeodomain-like
CDDcd001671.77E-132162No hitNo description
PROSITE profilePS5129427.36665119IPR017930Myb domain
SMARTSM007172.4E-1569117IPR001005SANT/Myb domain
PfamPF002495.9E-1570114IPR001005SANT/Myb domain
CDDcd001672.24E-1172115No hitNo description
Gene3DG3DSA:1.10.10.603.5E-2072118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MADGGGSGDD TIRGSCPRGH WRPAEDERLR QLVEQYGPQN WNSIAEKLQG RSGKSCRLRW  60
FNQLDPRINR RPFSEDEEER LVAAHRIHGN KWALISRLFP GRTDNAVKNH WHVLMARKQR  120
EQSKICGKRS LYQQRDRFQS DSKFPSYGFR RRNSNSSNNN NNTTKIQEGN YGSKINFFEF  180
QNPNKDRVFS MSTYTSNSPG RIGSHLFRES SINQKSLCQN NLSFLSHGGG DNNNYKRSKA  240
IQNPERNESD DITERVVNIS HTTFSLGKML RANIEQQLHY GEEAREKKDI PFIDFLGVGI  300
SS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-30181184104MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-301811858158MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-301811858158MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-30181184104C-Myb DNA-Binding Domain
1msf_C1e-30181184104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015073122.11e-169PREDICTED: transcription factor MYB59-like
TrEMBLK4BT451e-168K4BT45_SOLLC; Uncharacterized protein
STRINGSolyc04g064540.2.11e-167(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.15e-66myb domain protein 52